TA342215 SEMA3F antibody

Rabbit polyclonal Anti-Sema3f Antibody

See related secondary antibodies

Search for all "SEMA3F"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SEMA3F

TA342215

More Views

  • TA342215
  • TA342215
  • TA342215

Product Description for SEMA3F

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SEMA3F.
Presentation: Purified
Product is tested for Immunoprecipitation, Paraffin Sections, Western blot / Immunoblot.

Properties for SEMA3F

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Sema III/F, Sema IV, Semaphorin IV, Semaphorin-3F
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Ze
Applications IP, P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13275
Immunogen:
The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH.
GeneID:
6405
Application IP
IHC
WB
Background The function remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SEMA3F (1 products)

Catalog No. Species Pres. Purity   Source  

SEMA3F overexpression lysate

SEMA3F overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn