TA342230 NDUFS1 antibody

Rabbit polyclonal Anti-NDUFS1 Antibody

See related secondary antibodies

Search for all "NDUFS1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Zebrafish NDUFS1

TA342230

More Views

  • TA342230
  • TA342230

Product Description for NDUFS1

Rabbit anti Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Zebrafish NDUFS1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NDUFS1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CI-75kD, Complex I-75kD, NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
Presentation Purified
Reactivity Can, Eq, GP, Gt, Hu, Ms, Por, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P28331
Immunogen:
The immunogen for anti-NDUFS1 antibody: synthetic peptide directed towards the middle region of human NDUFS1. Synthetic peptide located within the following region: TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE.
GeneID:
4719
Application WB
Background The protein encoded byThis gene belongs toThe complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates atThe mitochondrial inner membrane.This protein has DH dehydrogese activity and oxidoreductase activity. It transfers electrons from DH toThe respiratory chain.The immediate electron acceptor forThe enzyme is believed to be ubiquinone.This protein isThe largest subunit of complex I and it is a component ofThe iron-sulfur (IP) fragment ofThe enzyme. It may form part ofThe active site crevice where DH is oxidized. Mutations inThis gene are associated with complex I deficiency. Several transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jan 2011].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NDUFS1 (3 products)

Catalog No. Species Pres. Purity   Source  

NDUFS1

NDUFS1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NDUFS1

NDUFS1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NDUFS1

NDUFS1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NDUFS1 (2 products)

Catalog No. Species Pres. Purity   Source  

NDUFS1 293T Cell Transient Overexpression Lysate(Denatured)

NDUFS1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Ndufs1 Lysate

Western Blot: Ndufs1 Lysate [NBL1-13560] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NDUFS1
  Novus Biologicals Inc.
  • LinkedIn