TA342240 GlnRS / QARS antibody

Rabbit polyclonal Anti-QARS Antibody

See related secondary antibodies

Search for all "GlnRS / QARS"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GlnRS / QARS

Product Description for GlnRS / QARS

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GlnRS / QARS.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GlnRS / QARS

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Glutamine-tRNA ligase, Glutaminyl-tRNA synthetase
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P47897
Immunogen:
The immunogen for anti-QARS antibody: synthetic peptide directed towards the N terminal of human QARS. Synthetic peptide located within the following region: DQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQV.
GeneID:
5859
Application WB
Background Aminoacyl-tR synthetases catalyzeThe aminoacylation of tR byTheir cogte amino acid. Because ofTheir central role in linking amino acids with nucleotide triplets contained in tRs, aminoacyl-tR synthetases are thought to be amongThe first proteins that appeared in evolution. In metazoans, 9 aminoacyl-tR synthetases specific for glutamine (gln), glutamic acid (glu), and 7 other amino acids are associated within a multienzyme complex. Although present in eukaryotes, glutaminyl-tR synthetase (QARS) is absent from many prokaryotes, mitochondria, and chloroplasts, in which Gln-tR(Gln) is formed by transamidation ofThe misacylated Glu-tR(Gln). Glutaminyl-tR synthetase belongs toThe class-I aminoacyl-tR synthetase family. Altertive splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GlnRS / QARS (5 products)

Catalog No. Species Pres. Purity   Source  

GlnRS / QARS

GlnRS / QARS Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GlnRS / QARS

GlnRS / QARS Human Purified
  Abnova Taiwan Corp.

GlnRS / QARS

GlnRS / QARS Human Purified
  Abnova Taiwan Corp.

GlnRS / QARS

GlnRS / QARS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GlnRS / QARS

GlnRS / QARS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GlnRS / QARS (1 products)

Catalog No. Species Pres. Purity   Source  

QARS 293T Cell Transient Overexpression Lysate(Denatured)

QARS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn