TA342247 MRE11 antibody

Rabbit polyclonal Anti-MRE11A Antibody

See related secondary antibodies

Search for all "MRE11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MRE11

Product Description for MRE11

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MRE11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MRE11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Double-strand break repair protein MRE11A, HNGS1, MRE11 homolog 1, MRE11 meiotic recombination 11 homolog A, MRE11A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P49959
Immunogen:
The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the N terminal of human MRE11A. Synthetic peptide located within the following region: DTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCM.
GeneID:
4361
Application WB
Background This gene encodes a nuclear protein involved in homologous recombition, telomere length maintence, and D double-strand break repair. By itself,The protein has 3' to 5' exonuclease activity and endonuclease activity.The protein forms a complex withThe RAD50 homolog;This complex is required for nonhomologous joining of D ends and possesses increased single-stranded D endonuclease and 3' to 5' exonuclease activities. In conjunction with a D ligase,This protein promotesThe joining of noncomplementary ends in vitro using short homologies nearThe ends ofThe D fragments.This gene has a pseudogene on chromosome 3. Altertive splicing ofThis gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MRE11 (3 products)

Catalog No. Species Pres. Purity   Source  

MRE11 (transcript variant 1)

MRE11 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MRE11

MRE11 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MRE11

MRE11 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MRE11 (1 products)

Catalog No. Species Pres. Purity   Source  

Mre11 Lysate

Western Blot: Mre11 Lysate [NBL1-13219] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MRE11A
  Novus Biologicals Inc.
  • LinkedIn