TA342287 ROR-gamma / RORC antibody

Rabbit Polyclonal Anti-Rorc Antibody

See related secondary antibodies

Search for all "ROR-gamma / RORC"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rat ROR-gamma / RORC

Product Description for ROR-gamma / RORC

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rat ROR-gamma / RORC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ROR-gamma / RORC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NR1F3, Nuclear receptor ROR-gamma, Nuclear receptor RZR-gamma, Nuclear receptor subfamily 1 group F member 3, RORG, RZRG, Retinoid-related orphan receptor-gamma
Presentation Purified
Reactivity Can, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P51449
Immunogen:
The immunogen for anti-Rorc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG.
GeneID:
6097
Application WB
Background Rorc is an orphan nuclear receptor. Isoform 2 negatively regulates expression of TNFSF6/FASL and IL2 production in T-cells. It also binds to the TEA promoter and may participate in the regulation of D accessibility in the TCR-Jalpha locus.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 34% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ROR-gamma / RORC (5 products)

Catalog No. Species Pres. Purity   Source  

ROR-gamma / RORC (transcript variant 1)

ROR-gamma / RORC Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ROR-gamma / RORC

ROR-gamma / RORC Human Purified
  Abnova Taiwan Corp.

ROR-gamma / RORC

ROR-gamma / RORC Human Purified
  Abnova Taiwan Corp.

ROR-gamma / RORC

ROR-gamma / RORC Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ROR-gamma / RORC

ROR-gamma / RORC Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ROR-gamma / RORC (2 products)

Catalog No. Species Pres. Purity   Source  

ROR gamma Lysate

Western Blot: ROR gamma Lysate [NBL1-15482] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RORC
  Novus Biologicals Inc.

ROR gamma Lysate

Western Blot: ROR gamma Lysate [NBL1-15483] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RORC
  Novus Biologicals Inc.
  • LinkedIn