TA342321 PDLIM1 antibody

Rabbit Polyclonal Anti-PDLIM1 Antibody

See related secondary antibodies

Search for all "PDLIM1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse, Rat PDLIM1

Product Description for PDLIM1

Rabbit anti Mouse, Rat PDLIM1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PDLIM1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C-terminal LIM domain protein 1, CLIM1, CLP-36, CLP36, Elfin, LIM domain protein CLP-36, PDZ and LIM domain protein 1
Presentation Purified
Reactivity Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O70400
Immunogen:
The immunogen for anti-PDLIM1 antibody: synthetic peptide directed towards the middle region of mouse PDLIM1. Synthetic peptide located within the following region: TSASGEEANSRPVVQPHPSGSLIIDKDSEVYKMLQEKQELNEPPKQSTSF.
GeneID:
54132
Application WB
Background Cytoskeletal protein that may act as an adapter that brings other proteins (like kises) to the cytoskeleton.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 68% sucrose.
State:
Purified

Accessory Products

  • LinkedIn