TA342342 ASCL3 antibody

Rabbit Polyclonal Anti-Ascl3 Antibody

See related secondary antibodies

Search for all "ASCL3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat ASCL3

Product Description for ASCL3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat ASCL3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ASCL3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Achaete-scute homolog 3, HASH3, SGN1, bHLH transcriptional regulator Sgn-1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQ33
Immunogen:
The immunogen for anti-Ascl3 antibody: synthetic peptide directed towards the middle region of mouse Ascl3. Synthetic peptide located within the following region: GYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLLYPDESETKKNPR.
GeneID:
56676
Application WB
Background Transcriptiol repressor. Inhibits myogenesis.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 89% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ASCL3 (5 products)

Catalog No. Species Pres. Purity   Source  

ASCL3

ASCL3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ASCL3

ASCL3 Human Purified
  Abnova Taiwan Corp.

ASCL3

ASCL3 Human Purified
  Abnova Taiwan Corp.

ASCL3

ASCL3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ASCL3

ASCL3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ASCL3 (1 products)

Catalog No. Species Pres. Purity   Source  

ASCL3 overexpression lysate

ASCL3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn