TA342353 ANO10 / TMEM16K antibody

Rabbit Polyclonal Anti-TMEM16K Antibody

See related secondary antibodies

Search for all "ANO10 / TMEM16K"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat, Zebrafish, African clawed frog ANO10 / TMEM16K

TA342353

More Views

  • TA342353
  • TA342353

Product Description for ANO10 / TMEM16K

Rabbit anti Bovine, Human, Mouse, Rat, Zebrafish, African clawed frog ANO10 / TMEM16K.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ANO10 / TMEM16K

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Anoctamin-10, Transmembrane protein 16K
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NW15
Immunogen:
Synthetic peptide directed towards the C terminal of human ANO10
AA Sequence:
LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA
GeneID:
55129
Application

Western blotting  (0.2 - 1 µg/ml).

Background TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel. It is highly expressed in the brain with intermediate levels in the retina and heart and low levels in the placenta, liver, lung, duodenum, kidney, testis and spleen. In brain areas, highest expression in the frontal and occipital cortices and in the cerebellum. Lower expression in the fetal brain than in the adult brain.
General Readings "Targeted next-generation sequencing of a 12.5 Mb homozygous region reveals ANO10 mutations in patients with autosomal-recessive cerebellar ataxia." Vermeer S., Hoischen A., Meijer R.P., Gilissen C., Neveling K., Wieskamp N., de Brouwer A., Koenig M., Anheim M., Assoum M., Drouot N., Todorovic S., Milic-Rasic V., Lochmuller H., Stevanin G., Goizet C., David A., Durr A. expand/collapse author list Knoers N. Am. J. Hum. Genet. 87:813-819(2010)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine, African clawed frog, Zebrafish
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteins for ANO10 / TMEM16K (2 products)

Catalog No. Species Pres. Purity   Source  

ANO10 / TMEM16K

ANO10 / TMEM16K Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ANO10 / TMEM16K

ANO10 / TMEM16K Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn