TA342354 NEOT2 antibody

Rabbit Polyclonal Anti-NETO2 Antibody

See related secondary antibodies

Search for all "NEOT2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NEOT2

Product Description for NEOT2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NEOT2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NEOT2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTCL2, Neuropilin and tolloid-like protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NC67
Immunogen:
The immunogen for anti-NETO2 antibody: synthetic peptide directed towards the N terminal of human NETO2. Synthetic peptide located within the following region: GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE.
GeneID:
81831
Application WB
Background This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in rats encodes a protein that modulates glutamate sigling in the brain by regulating kaite receptor function. Expression of this gene may be a biomarker for proliferating infantile hemangiomas. A pseudogene of this gene is located on the long arm of chromosome 8. Altertively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 101% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NEOT2 (4 products)

Catalog No. Species Pres. Purity   Source  

NEOT2

NEOT2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NEOT2

NEOT2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NEOT2

NEOT2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NEOT2

NEOT2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NEOT2 (2 products)

Catalog No. Species Pres. Purity   Source  

NETO2 Lysate

Western Blot: NETO2 Lysate [NBL1-13593] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NETO2
  Novus Biologicals Inc.

NETO2 overexpression lysate

NETO2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn