TA342365 TMEM30A / CDC50A antibody

Rabbit Polyclonal Anti-TMEM30A Antibody

See related secondary antibodies

Search for all "TMEM30A / CDC50A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish TMEM30A / CDC50A

TA342365

More Views

  • TA342365
  • TA342365

Product Description for TMEM30A / CDC50A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish TMEM30A / CDC50A.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TMEM30A / CDC50A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C6orf67, Cell cycle control protein 50A, Transmembrane protein 30A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NV96
Immunogen:
The immunogen for anti-TMEM30A antibody is: synthetic peptide directed towards the middle region of Human TMEM30A. Synthetic peptide located within the following region: FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC.
GeneID:
55754
Application WB
IHC
Background The function of this protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 112% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM30A / CDC50A (3 products)

Catalog No. Species Pres. Purity   Source  

TMEM30A / CDC50A (transcript variant 1)

TMEM30A / CDC50A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TMEM30A / CDC50A

TMEM30A / CDC50A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TMEM30A / CDC50A

TMEM30A / CDC50A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TMEM30A / CDC50A (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM30A overexpression lysate

TMEM30A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn