TA342372 CHGN antibody

Rabbit Polyclonal Anti-ChGn Antibody

See related secondary antibodies

Search for all "CHGN"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CHGN

TA342372

More Views

  • TA342372

Product Description for CHGN

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CHGN.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CHGN

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 4-N-acetylgalactosaminyltransferase 1, Beta4GalNAcT-1, CSGALNACT1, Chondroitin beta-1, Chondroitin sulfate N-acetylgalactosaminyltransferase 1, CsGalNAcT-1, GALNACT1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TDX6
Immunogen:
The immunogen for anti-ChGn antibody: synthetic peptide directed towards the C terminal of human ChGn. Synthetic peptide located within the following region: DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT.
GeneID:
55790
Application WB
Background ChGn transfers 1,4-N-acetylgalactosamine (Galc) from UDP-Galc to the non-reducing end of glucuronic acid (GlcUA). This protein is required for addition of the first Galc to the core tetrasaccharide linker and for elongation of chondroitin chains. It play an important role in chondroitin chain biosynthesis in cartilage.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 119% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CHGN (2 products)

Catalog No. Species Pres. Purity   Source  

CHGN

CHGN Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CHGN

CHGN Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CHGN (2 products)

Catalog No. Species Pres. Purity   Source  

ChGn 293T Cell Transient Overexpression Lysate(Denatured)

ChGn 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ChGn 293T Cell Transient Overexpression Lysate(Denatured)

ChGn 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn