TA342374 LAPTM4B antibody

Rabbit Polyclonal Anti-LAPTM4B Antibody

See related secondary antibodies

Search for all "LAPTM4B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LAPTM4B

TA342374

More Views

  • TA342374

Product Description for LAPTM4B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LAPTM4B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LAPTM4B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Lysosomal-associated transmembrane protein 4B, Lysosome-associated transmembrane protein 4-beta
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86VI4
Immunogen:
The immunogen for anti-LAPTM4B antibody: synthetic peptide directed towards the middle region of human LAPTM4B. Synthetic peptide located within the following region: YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS.
GeneID:
55353
Application WB
Background LAPTM4B is a multi-pass membrane protein. It belongs to the LAPTM4/LAPTM5 transporter family. LAPTM4b has active role in disease progression of malignt cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 121% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LAPTM4B (3 products)

Catalog No. Species Pres. Purity   Source  

LAPTM4B

LAPTM4B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

LAPTM4B

LAPTM4B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

LAPTM4B

LAPTM4B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn