TA342378 ADCY10 / SAC antibody

Rabbit Polyclonal Anti-SAC Antibody

See related secondary antibodies

Search for all "ADCY10 / SAC"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat ADCY10 / SAC

Product Description for ADCY10 / SAC

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat ADCY10 / SAC.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ADCY10 / SAC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Adenylate cyclase homolog, Adenylate cyclase type 10, Germ cell soluble adenylyl cyclase, Testicular soluble adenylyl cyclase
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96PN6
Immunogen:
Synthetic peptide directed towards the N terminal of human SAC
AA Sequence:
VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL
GeneID:
55811
Application Western blotting (0.2 - 1.0 µg/ml)
Background SAC belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.The protein encoded by this gene belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene.
General Readings Schmid,A., (2007) J. Gen. Physiol. 130 (1), 99-109
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Rabbit, Bovine, Dog
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ADCY10 / SAC (2 products)

Catalog No. Species Pres. Purity   Source  

ADCY10 / SAC

ADCY10 / SAC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ADCY10 / SAC

ADCY10 / SAC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn