TA342389 LHX8 antibody

Rabbit Polyclonal Anti-LHX8 Antibody

See related secondary antibodies

Search for all "LHX8"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LHX8

Product Description for LHX8

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LHX8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LHX8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LHX8, LIM homeobox protein 8, LIM/homeobox protein Lhx8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q68G74
Immunogen:
The immunogen for anti-LHX8 antibody: synthetic peptide directed towards the middle region of human LHX8. Synthetic peptide located within the following region: LSTGEEFALVEEKVLCRVHYDCMLDNLKREVENGNGISVEGALLTEQDVN.
GeneID:
431707
Application WB
Background The protein encoded by this gene is a member of the LIM homeobox family of proteins, which are involved in patterning and differentiation of various tissue types. These proteins contain two tandemly repeated cysteine-rich double-zinc finger motifs known as LIM domains, in addition to a D-binding homeodomain. This family member is a transcription factor that plays a role in tooth morphogenesis. It is also involved in oogenesis and in neurol differentiation. This gene is a candidate gene for cleft palate, and it is also associated with odontoma formation. Altertive splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 136% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for LHX8 (1 products)

Catalog No. Species Pres. Purity   Source  

LHX8 overexpression lysate

LHX8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn