TA342417 DRGX / PRRXL1 antibody

Rabbit Polyclonal Anti-DRGX Antibody

See related secondary antibodies

Search for all "DRGX / PRRXL1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish DRGX / PRRXL1

Product Description for DRGX / PRRXL1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish DRGX / PRRXL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DRGX / PRRXL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Dorsal root ganglia homeobox protein, Paired-related homeobox protein-like 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NNA5
Immunogen:
The immunogen for anti-DRGX antibody: synthetic peptide directed towards the N terminal of human DRGX. Synthetic peptide located within the following region: MVLMSCDQRLISLLLVGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQL.
GeneID:
644168
Application WB
Background Transcription factor required for the formation of correct projections from nociceptive sensory neurons to the dorsal horn of the spil cord and normal perception of pain.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 164% sucrose.
State:
Purified

Accessory Products

  • LinkedIn