TA342423 ZNF91 antibody

Rabbit Polyclonal Anti-ZNF91 Antibody

See related secondary antibodies

Search for all "ZNF91"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat ZNF91

Product Description for ZNF91

Rabbit anti Human, Mouse, Rat ZNF91.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF91

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HPF7, HTF10, Zinc finger protein 91, Zinc finger protein HTF10
Presentation Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q05481
Immunogen:
The immunogen for anti-ZNF91 antibody: synthetic peptide directed towards the N terminal of human ZNF91. Synthetic peptide located within the following region: HKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNW.
GeneID:
7644
Application WB
Background The ZNF91 gene encodes a zinc finger protein of the KRAB (Kruppel-associated box) subfamily (Bellefroid et al., 1991, 1993 [PubMed 2023909] [PubMed 8467795]).[supplied by OMIM, May 2010]. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1). Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordites used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combition :: DB068854.1, AK291256.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 170% sucrose.
State:
Purified

Accessory Products

  • LinkedIn