TA342440 ZNF138 antibody

Rabbit Polyclonal Anti-ZNF138 Antibody

See related secondary antibodies

Search for all "ZNF138"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish ZNF138

Product Description for ZNF138

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish ZNF138.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF138

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 138, pHZ-32, pHZ32
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B3KP35
Immunogen:
The immunogen for anti-ZNF138 antibody: synthetic peptide directed towards the middle region of human ZNF138. Synthetic peptide located within the following region: TFNWSTNLSKPKKIHTGEKPYKCEVCGKAFHQSSILTKHKIIRTGEKPYK.
GeneID:
7697
Application WB
Background May be involved in transcriptiol regulation as a repressor.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 187% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF138 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF138

ZNF138 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF138

ZNF138 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn