TA342470 HOMEZ antibody

Rabbit Polyclonal Anti-HOMEZ Antibody

See related secondary antibodies

Search for all "HOMEZ"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat HOMEZ

Product Description for HOMEZ

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat HOMEZ.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOMEZ

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HOMEZ, Homeobox and leucine zipper protein Homez, Homeodomain leucine zipper-containing factor, KIAA1443
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IX15
Immunogen:
The immunogen for anti-HOMEZ antibody: synthetic peptide directed towards the N terminal of human HOMEZ. Synthetic peptide located within the following region: KTFSYFPYPSLADIALLCLRYGLQMEKVKTWFMAQRLRCGISWSSEEIEE.
GeneID:
57594
Application WB
Background May function as a transcriptiol regulator.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 217% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HOMEZ (4 products)

Catalog No. Species Pres. Purity   Source  

HOMEZ

HOMEZ Human Purified
  Abnova Taiwan Corp.

HOMEZ

HOMEZ Human Purified
  Abnova Taiwan Corp.

HOMEZ

HOMEZ Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HOMEZ

HOMEZ Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for HOMEZ (2 products)

Catalog No. Species Pres. Purity   Source  

HOMEZ Lysate(Denatured)

HOMEZ Lysate(Denatured)
  Abnova Taiwan Corp.

HOMEZ overexpression lysate

HOMEZ overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn