TA342491 ZNF483 (Center) antibody

Rabbit Polyclonal Anti-ZNF483 Antibody

See related secondary antibodies

Search for all "ZNF483"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF483

Product Description for ZNF483

Rabbit anti Human ZNF483.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF483

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1962, ZKSCAN16, Zinc finger protein 483, Zinc finger protein with KRAB and SCAN domains 16
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight ZNF483: 85 kDA
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TF39
Immunogen:
Synthetic peptide directed towards the middle region of human ZNF483
AA Sequence:
QNKTLGSGSRGKKFDPDKSPFGHNFKETSDLIKHLRVYLRKKSRRYNESK
GeneID:
158399
Property Center
Application

Western blotting  (0.2 - 1 µg/ml).

Background ZNF483 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers, 1 KRAB domain and 1 SCAN box domain. ZNF483 may be involved in transcriptional regulation.
General Readings "Solution structure of zinc finger domain from human zinc finger protein 483." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF483 (5 products)

Catalog No. Species Pres. Purity   Source  

ZNF483 (transcript variant 2)

ZNF483 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZNF483

ZNF483 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF483

ZNF483 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF483

ZNF483 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF483

ZNF483 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF483 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF483 293T Cell Transient Overexpression Lysate(Denatured)

ZNF483 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF483 overexpression lysate

ZNF483 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn