TA342508 ZNF367 antibody

Rabbit Polyclonal Anti-ZNF367 Antibody

See related secondary antibodies

Search for all "ZNF367"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ZNF367

Product Description for ZNF367

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ZNF367.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF367

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C2H2 zinc finger protein ZFF29, ZFF29, Zinc finger protein 367
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7RTV3
Immunogen:
The immunogen for anti-ZNF367 antibody: synthetic peptide directed towards the C terminal of human ZNF367. Synthetic peptide located within the following region: GCLSRFTHANRHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWLARYWE.
GeneID:
195828
Application WB
Background ZNF367 is a transcriptiol activator. Isoform 1 may be involved in transcriptiol activation of erythroid genes.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 257% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF367 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF367 overexpression lysate

ZNF367 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn