TA342514 GAS7 antibody

Rabbit Polyclonal Anti-GAS7 Antibody

See related secondary antibodies

Search for all "GAS7"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GAS7

Product Description for GAS7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GAS7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GAS7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GAS-7, Growth arrest-specific protein 7, KIAA0394
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60861
Immunogen:
The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the C terminal of human GAS7. Synthetic peptide located within the following region: IRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGN.
GeneID:
8522
Application WB
Background Growth arrest-specific 7 is expressed primarily in termilly differentiated brain cells and predomintly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neurol development. Several transcript variants encoding proteins which vary in the N-terminus have been described. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 263% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GAS7 (12 products)

Catalog No. Species Pres. Purity   Source  

GAS7 (transcript variant b)

GAS7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GAS7 (transcript variant a)

GAS7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GAS7 (transcript variant d)

GAS7 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

GAS7 (Isoform B) (1-416, His-tag)

GAS7 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €740.00
  OriGene Technologies GmbH

GAS7 (Isoform B) (1-416, His-tag)

GAS7 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

GAS7

GAS7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GAS7

GAS7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GAS7

GAS7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GAS7

GAS7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GAS7

GAS7 Human Purified 95 % E. coli
  GenWay Biotech Inc.

GAS7

GAS7 Human Purified 95 % E. coli
  GenWay Biotech Inc.

GAS7

SDS-Page: GAS7 Protein [NBC1-22933] - GAS7, 49.8 kDa (436 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for GAS7 (4 products)

Catalog No. Species Pres. Purity   Source  

GAS7 293T Cell Transient Overexpression Lysate(Denatured)

GAS7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GAS7 Lysate

Western Blot: GAS7 Lysate [NBL1-10976] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GAS7
  Novus Biologicals Inc.

GAS7 overexpression lysate

GAS7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

GAS7 overexpression lysate

GAS7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn