TA342522 FOXN4 antibody

Rabbit Polyclonal Anti-FOXN4 Antibody

See related secondary antibodies

Search for all "FOXN4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine FOXN4

Product Description for FOXN4

Rabbit anti Bovine, Canine, Human, Mouse, Porcine FOXN4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXN4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Forkhead box protein N4
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96NZ1
Immunogen:
The immunogen for anti-FOXN4 antibody: synthetic peptide directed towards the middle region of human FOXN4. Synthetic peptide located within the following region: QGNLWEEMKDEGFSLDTLGAFADSPLGCDLGASGLTPASGGSDQSFPDLQ.
GeneID:
121643
Application WB
Background Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-amino acid D-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helices flanked by 2 large loops or wings. These transcription factors are involved in a variety of biologic processes as key regulators in development and metabolism (Li et al., 2004 [PubMed 15363391]).[supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combition :: BC146825.1 [ECO:0000332] Rseq introns :: single sample supports all introns ERS025094 [ECO:0000348] ##Evidence-Data-END##
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 271% sucrose.
State:
Purified

Accessory Products

  • LinkedIn