TA342530 Nephronectin antibody

Rabbit Polyclonal Anti-NPNT Antibody

See related secondary antibodies

Search for all "Nephronectin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Nephronectin

Product Description for Nephronectin

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Nephronectin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Nephronectin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EGFL6L, NPNT, POEM, Preosteoblast EGF-like repeat protein with MAM domain, Protein EGFL6-like
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UXI9
Immunogen:
The immunogen for anti-NPNT antibody: synthetic peptide directed towards the middle region of human NPNT. Synthetic peptide located within the following region: TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE.
GeneID:
255743
Application WB
Background Functiol ligand of integrin alpha-8/beta-1 in kidney development. Regulates the expression of GDNF with integrin alpha-8/beta-1 which is essential for kidney development. May also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 284% sucrose.
State:
Purified

Accessory Products

  • LinkedIn