PLEKHO1 / CKIP1

Product Description for PLEKHO1 / CKIP1

Rabbit anti Bovine, Human, Porcine, Rat PLEKHO1 / CKIP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	C-Jun-binding protein, CK2-interacting protein 1, CKIP-1, Casein kinase 2-interacting protein 1, HQ0024c, JBP, OC120, Osteoclast maturation-associated gene 120 protein, PH domain-containing family O member 1, Pleckstrin homology domain-containing family O member 1
Presentation	Purified
Reactivity	Bov, Hu, Por, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Immunogen	Swiss Prot Num: Q53GL0 Immunogen: The immunogen for anti-PLEKHO1 antibody: synthetic peptide directed towards the N terminal of human PLEKHO1. Synthetic peptide located within the following region: MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG. GeneID: 51177
Application	WB
Background	PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP).PLEKHO1 may function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kise 2 (CK2). PLEKHO1 appears to target ATM to the plasma membrane. PLEKHO1 appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. PLEKHO1 is also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.
Format	Buffer System: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 285% sucrose. State: Purified

Catalog No.	Species	Purity	Source
TP303969	PLEKHO1 / CKIP1
	Human	> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
				OriGene Technologies, Inc.
H00051177-P01-10	PLEKHO1 / CKIP1
	Human	12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
				Abnova Taiwan Corp.
H00051177-P01-25	PLEKHO1 / CKIP1
	Human	12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
				Abnova Taiwan Corp.

Catalog No.	Species
NBL1-14512	CKIP-1 Lysate

		Novus Biologicals Inc.
H00051177-T01	PLEKHO1 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
LY414081	PLEKHO1 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH