TA342551 NDRG2 antibody

Rabbit Polyclonal Anti-NDRG2 Antibody

See related secondary antibodies

Search for all "NDRG2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NDRG2

TA342551

More Views

  • TA342551

Product Description for NDRG2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NDRG2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for NDRG2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1248, SYLD
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UN36
Immunogen:
The immunogen for anti-NDRG2 antibody: synthetic peptide directed towards the C terminal of human NDRG2. Synthetic peptide located within the following region: GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG.
GeneID:
57447
Application WB
IHC
Background This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several altertively spliced transcript variants of this gene have been described, but the full-length ture of some of these variants has not been determined. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 308% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NDRG2 (17 products)

Catalog No. Species Pres. Purity   Source  

NDRG2 (transcript variant 5)

NDRG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NDRG2 (transcript variant 8)

NDRG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NDRG2 (transcript variant 2)

NDRG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NDRG2 (transcript variant 4)

NDRG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NDRG2 (transcript variant 7)

NDRG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NDRG2 (transcript variant 1)

NDRG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NDRG2 (transcript variant 6)

NDRG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NDRG2 (full length, N-term HIS tag, transcript variant 3)

NDRG2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

NDRG2 (1-357, His-tag)

NDRG2 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

NDRG2 (1-357, His-tag)

NDRG2 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

NDRG2

NDRG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NDRG2

NDRG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NDRG2

NDRG2 Human Purified
  Abnova Taiwan Corp.

NDRG2

NDRG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NDRG2

NDRG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NDRG2

NDRG2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NDRG2

NDRG2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NDRG2 (17 products)

Catalog No. Species Pres. Purity   Source  

NDRG2 293T Cell Transient Overexpression Lysate(Denatured)

NDRG2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NDRG2 Lysate

Western Blot: NDRG2 Lysate [NBL1-13530] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NDRG2
  Novus Biologicals Inc.

NDRG2 Lysate

Western Blot: NDRG2 Lysate [NBL1-13531] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NDRG2
  Novus Biologicals Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

NDRG2 overexpression lysate

NDRG2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn