TA342558 USP8 / UBPY antibody

Rabbit Polyclonal Anti-USP8 Antibody

See related secondary antibodies

Search for all "USP8 / UBPY"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish USP8 / UBPY

Product Description for USP8 / UBPY

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish USP8 / UBPY.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for USP8 / UBPY

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Deubiquitinating enzyme 8, KIAA0055, Ubiquitin carboxyl-terminal hydrolase 8, Ubiquitin thioesterase 8, Ubiquitin-specific-processing protease 8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P40818
Immunogen:
The immunogen for anti-USP8 antibody: synthetic peptide directed towards the C terminal of human USP8. Synthetic peptide located within the following region: FAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA.
GeneID:
9101
Application WB
Background USP8 is a hydrolase that can remove conjugated ubiquitin from proteins and therefore plays an important regulatory role at the level of protein turnover by preventing degradation. USP8 converts both 'Lys-48' an 'Lys-63'-linked ubiquitin chains. USP8 catalytic activity is enhanced in the M phase. USP8 is involved in cell proliferation. USP8 is required to enter into S phase in response to serum stimulation. USP8 may regulate T-cell anergy mediated by RNF128 via the formation of a complex containing RNF128 and OTUB1. USP8 probably regulates the stability of STAM2 and RASGRF1. USP8 regulates endosomal ubiquitin dymics, cargo sorting, membrane traffic at early endosomes, and maintence of ESCRT-0 stability. The level of protein ubiquitition on endosomes is essential for maintaining the morphology of the organelle.USP8 deubiquitites EPS15 and controles tyrosine kise stability.USP8 removes conjugated ubiquitin from EGFR thus regulating EGFR degradation and downstream MAPK sigling. USP8 is involved in acrosome biogenesis through interaction with the spermatid ESCRT-0 complex and microtubules.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 315% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for USP8 / UBPY (4 products)

Catalog No. Species Pres. Purity   Source  

USP8 / UBPY (transcript variant 1)

USP8 / UBPY Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

USP8 / UBPY (transcript variant 2)

USP8 / UBPY Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

USP8 / UBPY

USP8 / UBPY Human
  Abnova Taiwan Corp.

USP8 / UBPY

USP8 / UBPY Human
  Abnova Taiwan Corp.

Positive controls for USP8 / UBPY (1 products)

Catalog No. Species Pres. Purity   Source  

UBPY/USP8 Lysate

Western Blot: UBPY/USP8 Lysate [NBL1-17672] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for USP8
  Novus Biologicals Inc.
  • LinkedIn