Home » USP15

TA342568 USP15 antibody

Rabbit Polyclonal Anti-USP15 Antibody

Search for all "USP15"

0.1 ml / €360.00

Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

View Datasheet

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat USP15

More Views

Product Description for USP15

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat USP15.
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for USP15

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	Deubiquitinating enzyme 15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4
Presentation	Purified
Reactivity	Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications	ICC/IF, WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: Q9Y4E8 Immunogen: The immunogen for anti-USP15 antibody: synthetic peptide directed towards the C terminal of human USP15. Synthetic peptide located within the following region: GNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAED. GeneID: 9958
Application	WB IF
Background	Ubiquitin (MIM 191339), a highly conserved protein involved in the regulation of intracellular protein breakdown, cell cycle regulation, and stress response, is released from degraded proteins by disassembly of the polyubiquitin chains. The disassembly process is mediated by ubiquitin-specific proteases (USPs). Also see USP1 (MIM 603478).
Format	Buffer System: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 325% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for USP15 (6 products)

Catalog No.	Species	Pres.	Purity	Source
TP322642	USP15
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €788.00
					OriGene Technologies, Inc.
AR51061PU-N	USP15 (1-235, His-tag)
	Human	Purified	> 90 % by SDS - PAGE	E. coli	0.25 mg / €1,070.00
					OriGene Technologies GmbH
AR51061PU-S	USP15 (1-235, His-tag)
	Human	Purified	> 90 % by SDS - PAGE	E. coli	50 µg / €400.00
					OriGene Technologies GmbH
H00009958-P01-10	USP15
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00009958-P01-25	USP15
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
P0939	USP15
	Human
					Abnova Taiwan Corp.

Positive controls for USP15 (1 products)

Catalog No.	Species
LY416729	USP15 overexpression lysate
		0.1 mg / €495.00
		OriGene Technologies, Inc.

Recommended Secondary Antibodies for USP15 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH

Click here to see all secondary antibodies for USP15

Antibodies (see all»)

Kits (see all»)

Antigens

Lysates (see all»)