TA342569 USP2 antibody

Rabbit Polyclonal Anti-USP2 Antibody

See related secondary antibodies

Search for all "USP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat USP2

Product Description for USP2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat USP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for USP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 2UBP41, 41 kDa ubiquitin-specific protease, Deubiquitinating enzyme 2, Ubiquitin carboxyl-terminal hydrolase, Ubiquitin thioesterase 2, Ubiquitin-specific-processing protease 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75604
Immunogen:
The immunogen for anti-USP2 antibody: synthetic peptide directed towards the middle region of human USP2. Synthetic peptide located within the following region: NEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK.
GeneID:
9099
Application WB
Background Ubiquitin (MIM 191339), a highly conserved protein involved in the regulation of intracellular protein breakdown, cell cycle regulation, and stress response, is released from degraded proteins by disassembly of the polyubiquitin chains. The disassembly process is mediated by ubiquitin-specific proteases (USPs). Also see USP1 (MIM 603478).
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 326% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for USP2 (3 products)

Catalog No. Species Pres. Purity   Source  

USP2 (transcript variant 2)

USP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

USP2

USP2 Human
  Abnova Taiwan Corp.

USP2

USP2 Human
  Abnova Taiwan Corp.

Positive controls for USP2 (4 products)

Catalog No. Species Pres. Purity   Source  

USP2 293T Cell Transient Overexpression Lysate(Denatured)

USP2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

USP2 Lysate

Western Blot: USP2 Lysate [NBL1-17650] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for USP2
  Novus Biologicals Inc.

USP2 overexpression lysate

USP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

USP2 overexpression lysate

USP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn