TA342577 USP6 / TRE2 antibody

Rabbit Polyclonal Anti-USP6 Antibody

See related secondary antibodies

Search for all "USP6 / TRE2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat USP6 / TRE2

Product Description for USP6 / TRE2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat USP6 / TRE2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for USP6 / TRE2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Deubiquitinating enzyme 6, HRP1, TRE-2, Ubiquitin carboxyl-terminal hydrolase 6, Ubiquitin thioesterase 6, Ubiquitin-specific-processing protease 6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P35125
Immunogen:
The immunogen for anti-USP6 antibody is: synthetic peptide directed towards the C-terminal region of Human USP6. Synthetic peptide located within the following region: NHSEEDSTDDQREDTHIKPIYNLYAISCHSGILSGGHYITYAKNPNCKWY.
GeneID:
9098
Application WB
Background USP6 is a deubiquitise with an ATP-independent isopeptidase activity, cleaving at the C-terminus of the ubiquitin moiety. It catalyzes its own deubiquitition. In vitro, isoform 2, but not isoform 3, shows deubiquititing activity. USP6 promotes plasma membrane localization of ARF6 and selectively regulates ARF6-dependent endocytic protein trafficking. It is able to initiate tumorigenesis by inducing the production of matrix metalloproteises following NF-kappa-B activation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 334% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for USP6 / TRE2 (4 products)

Catalog No. Species Pres. Purity   Source  

USP6 / TRE2

USP6 / TRE2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

USP6 / TRE2

USP6 / TRE2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

USP6 / TRE2

USP6 / TRE2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

USP6 / TRE2

USP6 / TRE2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn