TA342607 MLF1IP antibody

Rabbit Polyclonal Anti-CENPU Antibody

See related secondary antibodies

Search for all "MLF1IP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MLF1IP

TA342607

Product Description for MLF1IP

Rabbit anti Human MLF1IP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MLF1IP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CENP-U(50), CENPU, Centromere protein U, ICEN24, Interphase centromere complex protein 24, KLIP1, KSHV latent nuclear antigen-interacting protein 1, MLF1-interacting protein, PBIP, Polo-box-interacting protein 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q71F23
Immunogen:
The immunogen for anti-MLF1IP antibody is: synthetic peptide directed towards the C-terminal region of Human MLF1IP. Synthetic peptide located within the following region: ISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHL.
GeneID:
79682
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 364% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MLF1IP (4 products)

Catalog No. Species Pres. Purity   Source  

MLF1IP (147-418, His-tag)

MLF1IP Human Purified > 80 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

MLF1IP (147-418, His-tag)

MLF1IP Human Purified > 80 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

MLF1IP

MLF1IP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MLF1IP

MLF1IP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn