TA342612 Contactin-1 antibody

Rabbit Polyclonal Anti-CNTN1 Antibody

See related secondary antibodies

Search for all "Contactin-1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Contactin-1

Product Description for Contactin-1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Contactin-1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Contactin-1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CNTN1, F3cam, Glycoprotein gp135, Neural cell surface protein F3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q12860
Immunogen:
The immunogen for anti-CNTN1 antibody: synthetic peptide directed towards the middle region of human CNTN1. Synthetic peptide located within the following region: QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYW.
GeneID:
1272
Application WB
Background The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neurol membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. Two altertively spliced transcript variants encoding different isoforms have been described for this gene.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 369% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Contactin-1 (2 products)

Catalog No. Species Pres. Purity   Source  

Contactin-1 (transcript variant 2)

Contactin-1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Contactin-1 (Fc Chimera)

Contactin-1 Human Purified > 90 %
0.1 mg / €410.00
  Neuromics Antibodies

Positive controls for Contactin-1 (3 products)

Catalog No. Species Pres. Purity   Source  

CNTN1 overexpression lysate

CNTN1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CNTN1 overexpression lysate

CNTN1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

Contactin 1 Lysate

Western Blot: Contactin 1 Lysate [NBL1-09333] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CNTN1
  Novus Biologicals Inc.
  • LinkedIn