TA342615 POFUT1 antibody

Rabbit Polyclonal Anti-POFUT1 Antibody

See related secondary antibodies

Search for all "POFUT1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish POFUT1

Product Description for POFUT1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish POFUT1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POFUT1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FUT12, GDP-fucose protein O-fucosyltransferase 1, KIAA0180, O-FucT-1, Peptide-O-fucosyltransferase 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H488
Immunogen:
The immunogen for anti-POFUT1 antibody: synthetic peptide directed towards the middle region of human POFUT1. Synthetic peptide located within the following region: RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP.
GeneID:
23509
Application WB
Background This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor sigling. Altertive splicing of this gene results in two transcript variants encoding different isoforms.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 372% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for POFUT1 (7 products)

Catalog No. Species Pres. Purity   Source  

POFUT1 (transcript variant 1)

POFUT1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

POFUT1 (His-tag)

POFUT1 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

POFUT1 (His-tag)

POFUT1 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

POFUT1

POFUT1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

POFUT1

POFUT1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

POFUT1

POFUT1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

POFUT1

POFUT1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for POFUT1 (1 products)

Catalog No. Species Pres. Purity   Source  

POFUT1 overexpression lysate

POFUT1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn