TA342625 Synaptotagmin-11 antibody

Rabbit Polyclonal Anti-SYT11 Antibody

See related secondary antibodies

Search for all "Synaptotagmin-11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Synaptotagmin-11

Product Description for Synaptotagmin-11

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Synaptotagmin-11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Synaptotagmin-11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0080, SYT-11, SYT11, Synaptotagmin 11, Synaptotagmin XI, SytXI
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BT88
Immunogen:
The immunogen for anti-SYT11 antibody: synthetic peptide directed towards the N terminal of human SYT11. Synthetic peptide located within the following region: PPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAE.
GeneID:
23208
Application WB
Background This gene is a member of the syptotagmin gene family and encodes a protein similar to other family members that are known calcium sensors and mediate calcium-dependent regulation of membrane trafficking in syptic transmission. The encoded protein is also a substrate for ubiquitin-E3-ligase parkin. The gene has previously been referred to as syptotagmin XII but has been remed syptotagmin XI to be consistent with mouse and rat official nomenclature.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 382% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Synaptotagmin-11 (2 products)

Catalog No. Species Pres. Purity   Source  

Synaptotagmin-11

Synaptotagmin-11 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Synaptotagmin-11

Synaptotagmin-11 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Synaptotagmin-11 (1 products)

Catalog No. Species Pres. Purity   Source  

SYT11 Lysate

Western Blot: SYT11 Lysate [NBL1-16647] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SYT11
  Novus Biologicals Inc.
  • LinkedIn