TA342645 Vasopressin V2 receptor (AVPR2) antibody

Rabbit Polyclonal Anti-AVPR2 Antibody

See related secondary antibodies

Search for all "Vasopressin V2 receptor (AVPR2)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep Vasopressin V2 receptor (AVPR2)

TA342645

More Views

  • TA342645
  • TA342645

Product Description for Vasopressin V2 receptor (AVPR2)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep Vasopressin V2 receptor (AVPR2).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Vasopressin V2 receptor (AVPR2)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADHR, AVPR V2, Antidiuretic hormone receptor, DIR, DIR3, Renal-type arginine vasopressin receptor, V2R
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P30518
Immunogen:
The immunogen for anti-AVPR2 antibody: synthetic peptide directed towards the C terminal of human AVPR2. Synthetic peptide located within the following region: NPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTS.
GeneID:
554
Application WB
Background This gene encodes the vasopressin receptor, type 2, also known as the V2 receptor, which belongs to the seven-transmembrane-domain G protein-coupled receptor (GPCR) superfamily, and couples to Gs thus stimulating adenylate cyclase. The subfamily that includes the V2 receptor, the V1a and V1b vasopressin receptors, the oxytocin receptor, and isotocin and mesotocin receptors in non-mammals, is well conserved, though several members sigl via other G proteins. All bind similar cyclic nopeptide hormones. The V2 receptor is expressed in the kidney tubule, predomintly in the distal convoluted tubule and collecting ducts, where its primary property is to respond to the pituitary hormone arginine vasopressin (AVP) by stimulating mechanisms that concentrate the urine and maintain water homeostasis in the organism. When the function of this gene is lost, the disease Nephrogenic Diabetes Insipidus (NDI) results. The V2 receptor is also expressed outside the kidney although its tissue localization is uncertain. When these 'extrarel receptors' are stimulated by infusion of a V2 selective agonist (dDAVP), a variety of clotting factors are released into the bloodstream. The physiologic importance of this property is not known - its absence does not appear to be detrimental in NDI patients. The gene expression has also been described in fetal lung tissue and lung cancer associated with altertive splicing.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 402% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Vasopressin V2 receptor (AVPR2) (2 products)

Catalog No. Species Pres. Purity   Source  

AVPR2 Lysate

Western Blot: AVPR2 Lysate [NBL1-07867] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AVPR2 Protein
  Novus Biologicals Inc.

AVPR2 overexpression lysate

AVPR2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn