TA342650 SSTR1 antibody

Rabbit Polyclonal Anti-SSTR1 Antibody

See related secondary antibodies

Search for all "SSTR1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish SSTR1

Product Description for SSTR1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish SSTR1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SSTR1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SRIF-2, SS-1-R, SS1-R, SS1R, Somatostatin receptor type 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P30872
Immunogen:
The immunogen for anti-Sstr1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sstr1. Synthetic peptide located within the following region: QRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTC.
GeneID:
6751
Application WB
Background Sstr1 is a receptor for somatostatin with higher affinity for somatostatin-14 than -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and +/H+ exchanger via pertussis toxin insensitive G proteins.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 407% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SSTR1 (5 products)

Catalog No. Species Pres. Purity   Source  

SSTR1

SSTR1 Human
  Abnova Taiwan Corp.

SSTR1

SSTR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SSTR1

SSTR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SSTR1

SSTR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SSTR1

SSTR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SSTR1 (1 products)

Catalog No. Species Pres. Purity   Source  

Somatostatin Receptor 1 Lysate

Western Blot: Somatostatin Receptor 1 Lysate [NBL1-16477] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SSTR1
  Novus Biologicals Inc.
  • LinkedIn