TA342665 ALDH9A1 / ALDH9 antibody

Rabbit Polyclonal Anti-ALDH9A1 Antibody

See related secondary antibodies

Search for all "ALDH9A1 / ALDH9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ALDH9A1 / ALDH9

TA342665

More Views

  • TA342665
  • TA342665

Product Description for ALDH9A1 / ALDH9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ALDH9A1 / ALDH9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ALDH9A1 / ALDH9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 4-trimethylaminobutyraldehyde dehydrogenase, Aldehyde dehydrogenase E3 isozyme, Aldehyde dehydrogenase family 9 member A1, Gamma-aminobutyraldehyde dehydrogenase, R-aminobutyraldehyde dehydrogenase, TMABADH
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P49189
Immunogen:
The immunogen for anti-ALDH9A1 antibody: synthetic peptide directed towards the C terminal of human ALDH9A1. Synthetic peptide located within the following region: MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC.
GeneID:
223
Application WB
Background This protein belongs to the aldehyde dehydrogese family of proteins. It has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. The enzyme catalyzes the dehydrogetion of gamma-aminobutyraldehyde to gamma-aminobutyric acid (GABA). This isozyme is a tetramer of identical 54-kD subunits.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 422% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ALDH9A1 / ALDH9 (5 products)

Catalog No. Species Pres. Purity   Source  

ALDH9A1 / ALDH9

ALDH9A1 / ALDH9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ALDH9A1 / ALDH9

ALDH9A1 / ALDH9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALDH9A1 / ALDH9

ALDH9A1 / ALDH9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALDH9A1 / ALDH9

ALDH9A1 / ALDH9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ALDH9A1 / ALDH9

ALDH9A1 / ALDH9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ALDH9A1 / ALDH9 (1 products)

Catalog No. Species Pres. Purity   Source  

ALDH9A1 293T Cell Transient Overexpression Lysate(Denatured)

ALDH9A1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn