TA342670 mGluR7 / GRM7 antibody

Rabbit Polyclonal Anti-GRM7 Antibody

See related secondary antibodies

Search for all "mGluR7 / GRM7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish mGluR7 / GRM7

Product Description for mGluR7 / GRM7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish mGluR7 / GRM7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for mGluR7 / GRM7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GPRC1G, MGLUR7, Metabotropic glutamate receptor 7
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14831
Immunogen:
The immunogen for anti-GRM7 antibody: synthetic peptide directed towards the C terminal of human GRM7. Synthetic peptide located within the following region: HPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS.
GeneID:
2917
Application WB
Background L-glutamate is the major excitatory neurotransmitter in the central nervous system, and it activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors that have been divided into three groups on the basis of sequence homology, putative sigl transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5, and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3, while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Multiple transcript variants encoding different isoforms have been found for this gene.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 427% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for mGluR7 / GRM7 (5 products)

Catalog No. Species Pres. Purity   Source  

mGluR7 / GRM7

mGluR7 / GRM7 Human
  Abnova Taiwan Corp.

mGluR7 / GRM7

mGluR7 / GRM7 Human Purified
  Abnova Taiwan Corp.

mGluR7 / GRM7

mGluR7 / GRM7 Human Purified
  Abnova Taiwan Corp.

mGluR7 / GRM7

mGluR7 / GRM7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

mGluR7 / GRM7

mGluR7 / GRM7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for mGluR7 / GRM7 (1 products)

Catalog No. Species Pres. Purity   Source  

Metabotropic Glutamate Receptor 7 Lysate

Western Blot: Metabotropic Glutamate Receptor 7 Lysate [NBL1-11351] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for GRM7.
  Novus Biologicals Inc.
  • LinkedIn