TA342676 Cerebellin-1 antibody

Rabbit Polyclonal Anti-CBLN1 Antibody

See related secondary antibodies

Search for all "Cerebellin-1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Cerebellin-1

Product Description for Cerebellin-1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Cerebellin-1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cerebellin-1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CBLN1, Precerebellin
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P23435
Immunogen:
The immunogen for anti-CBLN1 antibody: synthetic peptide directed towards the C terminal of human CBLN1. Synthetic peptide located within the following region: LMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGW.
GeneID:
869
Application WB
Background This gene encodes a cerebellum-specific precursor protein, precerebellin, with similarity to the globular (non-collagen-like) domain of complement component C1qB. Precerebellin is processed to give rise to several derivatives, including the hexadecapeptide, cerebellin, which is highly enriched in postsyptic structures of Purkinje cells. Cerebellin has also been found in human and rat adrels, where it has been shown to enhance the secretory activity of this gland.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 433% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cerebellin-1 (2 products)

Catalog No. Species Pres. Purity   Source  

Cerebellin-1

Cerebellin-1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Cerebellin-1

Cerebellin-1 Human Purified Solid phase synthesis - HPLC: >99%
  OriGene Technologies GmbH

Positive controls for Cerebellin-1 (2 products)

Catalog No. Species Pres. Purity   Source  

CBLN1 overexpression lysate

CBLN1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Precerebellin Lysate

Western Blot: Precerebellin Lysate [NBL1-08739] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CBLN1
  Novus Biologicals Inc.
  • LinkedIn