TA342684 RAB4A / RAB4 antibody

Rabbit Polyclonal Anti-RAB4A Antibody

See related secondary antibodies

Search for all "RAB4A / RAB4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish RAB4A / RAB4

Product Description for RAB4A / RAB4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish RAB4A / RAB4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RAB4A / RAB4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Rab-4A, Ras-related protein Rab-4A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P20338
Immunogen:
The immunogen for anti-RAB4A antibody is: synthetic peptide directed towards the C-terminal region of Human RAB4A. Synthetic peptide located within the following region: VQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECG.
GeneID:
5867
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 441% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB4A / RAB4 (7 products)

Catalog No. Species Pres. Purity   Source  

RAB4A / RAB4

RAB4A / RAB4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RAB4A / RAB4 (1-218, His-tag)

Recombinant human RAB4A, 1-218aa, His-tagged Human Purified > 90 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

RAB4A / RAB4 (1-218, His-tag)

Recombinant human RAB4A, 1-218aa, His-tagged Human Purified > 90 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

RAB4A / RAB4

RAB4A / RAB4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAB4A / RAB4

RAB4A / RAB4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAB4A / RAB4

RAB4A / RAB4 Human Purified 95 % E. coli
  GenWay Biotech Inc.

RAB4A / RAB4

RAB4A / RAB4 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for RAB4A / RAB4 (2 products)

Catalog No. Species Pres. Purity   Source  

RAB4A 293T Cell Transient Overexpression Lysate(Denatured)

RAB4A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Rab4 Lysate

Western Blot: Rab4 Lysate [NBL1-15080] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RAB4A
  Novus Biologicals Inc.
  • LinkedIn