TA342686 STARD8 antibody

Rabbit Polyclonal Anti-STARD8 Antibody

See related secondary antibodies

Search for all "STARD8"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human STARD8

TA342686

More Views

  • TA342686

Product Description for STARD8

Rabbit anti Human STARD8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for STARD8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DLC-3, DLC3, Deleted in liver cancer 3 protein, KIAA0189, START domain-containing protein 8, START-GAP3, StAR-related lipid transfer protein 8
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92502
Immunogen:
The immunogen for anti-STARD8 antibody: synthetic peptide directed towards the N terminal of human STARD8. Synthetic peptide located within the following region: KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG.
GeneID:
9754
Application WB
Background This gene encodes a member of a subfamily of Rho GTPase activating proteins that contain a steroidogenic acute regulatory protein related lipid transfer domain. The encoded protein localizes to focal adhesions and may be involved in regulating cell morphology. This protein may also function as a tumor suppressor.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 443% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for STARD8 (3 products)

Catalog No. Species Pres. Purity   Source  

STARD8

STARD8 Human Purified
  Abnova Taiwan Corp.

STARD8

STARD8 Human
  Abnova Taiwan Corp.

STARD8

STARD8 Human Purified
  Abnova Taiwan Corp.

Positive controls for STARD8 (2 products)

Catalog No. Species Pres. Purity   Source  

STARD8 293T Cell Transient Overexpression Lysate(Denatured)

STARD8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

STARD8 overexpression lysate

STARD8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn