TA342694 Olfactory receptor 1C1 antibody

Rabbit Polyclonal Anti-OR1C1 Antibody

See related secondary antibodies

Search for all "Olfactory receptor 1C1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Porcine Olfactory receptor 1C1

TA342694

Product Description for Olfactory receptor 1C1

Rabbit anti Human, Porcine Olfactory receptor 1C1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Olfactory receptor 1C1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms OR1C1, Olfactory receptor OR1-42, Olfactory receptor TPCR27
Presentation Purified
Reactivity Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15619
Immunogen:
The immunogen for anti-OR1C1 antibody: synthetic peptide directed towards the C terminal of human OR1C1. Synthetic peptide located within the following region: AVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVSTCSCHLSVVVL.
GeneID:
26188
Application WB
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 452% sucrose.
State:
Purified

Accessory Products

  • LinkedIn