TA342695 Olfactory receptor 1D2 antibody

Rabbit Polyclonal Anti-OR1D2 Antibody

See related secondary antibodies

Search for all "Olfactory receptor 1D2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Olfactory receptor 1D2

Product Description for Olfactory receptor 1D2

Rabbit anti Human Olfactory receptor 1D2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Olfactory receptor 1D2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms OLFR1, OR1D2, Olfactory receptor 17-4, Olfactory receptor OR17-6, Olfactory receptor-like protein HGMP07E
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P34982
Immunogen:
The immunogen for anti-OR1D2 antibody: synthetic peptide directed towards the C terminal of human OR1D2. Synthetic peptide located within the following region: LHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGALGRLLDKHFKRLT.
GeneID:
4991
Application WB
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 453% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Olfactory receptor 1D2 (1 products)

Catalog No. Species Pres. Purity   Source  

OR1D2 overexpression lysate

OR1D2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn