TA342714 Olfactory receptor 2J2 antibody

Rabbit Polyclonal Anti-OR2J2 Antibody

See related secondary antibodies

Search for all "Olfactory receptor 2J2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Porcine, Rabbit Olfactory receptor 2J2

Product Description for Olfactory receptor 2J2

Rabbit anti Bovine, Equine, Human, Porcine, Rabbit Olfactory receptor 2J2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Olfactory receptor 2J2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Hs6M1-6, OR2J2, Olfactory receptor 6-8, Olfactory receptor OR6-19
Presentation Purified
Reactivity Bov, Eq, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O76002
Immunogen:
The immunogen for anti-OR2J2 antibody: synthetic peptide directed towards the C terminal of human OR2J2. Synthetic peptide located within the following region: STTGLQKVFRTCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYT.
GeneID:
26707
Application WB
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 472% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Olfactory receptor 2J2 (4 products)

Catalog No. Species Pres. Purity   Source  

Olfactory receptor 2J2

Olfactory receptor 2J2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Olfactory receptor 2J2

Olfactory receptor 2J2 Human
  Abnova Taiwan Corp.

Olfactory receptor 2J2

Olfactory receptor 2J2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Olfactory receptor 2J2

Olfactory receptor 2J2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn