TA342721 ALDH3 antibody

Rabbit Polyclonal Anti-ALDH3A1 Antibody

See related secondary antibodies

Search for all "ALDH3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rat ALDH3

TA342721

More Views

  • TA342721
  • TA342721

Product Description for ALDH3

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rat ALDH3.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ALDH3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ALDH3A1, ALDHIII, Aldehyde dehydrogenase, Aldehyde dehydrogenase 3, Aldehyde dehydrogenase family 3 member A1, dimeric NADP-preferring
Presentation Purified
Reactivity Bov, Can, GP, Hu, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P30838
Immunogen:
The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the N terminal of human ALDH3A1. Synthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI.
GeneID:
218
Application WB
IHC
Background Aldehyde dehydrogeses oxidize various aldehydes to the corresponding acids. They are involved in the detoxification of alcohol-derived acetaldehyde and in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. The enzyme encoded by this gene forms a cytoplasmic homodimer that preferentially oxidizes aromatic and medium-chain (6 carbons or more) saturated and unsaturated aldehyde substrates. It is thought to promote resistance to UV and 4-hydroxy-2-nonel-induced oxidative damage in the cornea. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Multiple altertively spliced variants, encoding the same protein, have been identified.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 479% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ALDH3 (9 products)

Catalog No. Species Pres. Purity   Source  

ALDH3 (transcript variant 2)

ALDH3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ALDH3 (transcript variant 3)

ALDH3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ALDH3 (transcript variant 1)

ALDH3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ALDH3 (1-453, His-tag)

ALDH3 Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

ALDH3 (1-453, His-tag)

ALDH3 Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

ALDH3

ALDH3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALDH3

ALDH3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALDH3

ALDH3 Human
  Abnova Taiwan Corp.

ALDH3

SDS-Page: ALDH3A1 Protein [NBP1-37091] - ALDH3A1, 52.5 kDa (473aa)  with a purity of 95% by SDS - PAGE
  Novus Biologicals Inc.

Positive controls for ALDH3 (4 products)

Catalog No. Species Pres. Purity   Source  

ALDH3A1 293T Cell Transient Overexpression Lysate(Denatured)

ALDH3A1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ALDH3A1 Lysate

Western Blot: ALDH3A1 Lysate [NBL1-07455] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ALDH3A1 Protein
  Novus Biologicals Inc.

ALDH3A1 overexpression lysate

ALDH3A1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

ALDH3A1 overexpression lysate

ALDH3A1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn