TA342739 Opsin-3 antibody

Rabbit Polyclonal Anti-OPN3 Antibody

See related secondary antibodies

Search for all "Opsin-3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Porcine Opsin-3

Product Description for Opsin-3

Rabbit anti Equine, Guinea Pig, Human, Porcine Opsin-3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Opsin-3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ECPN, Encephalopsin, OPN3, Panopsin
Presentation Purified
Reactivity Eq, GP, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H1Y3
Immunogen:
The immunogen for anti-OPN3 antibody: synthetic peptide directed towards the C terminal of human OPN3. Synthetic peptide located within the following region: IVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQV.
GeneID:
23596
Application WB
Background Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. In addition to the visual opsins, mammals possess several photoreceptive non-visual opsins that are expressed in extraocular tissues. This gene, opsin 3, is strongly expressed in brain and testis and weakly expressed in liver, placenta, heart, lung, skeletal muscle, kidney, and pancreas. The gene may also be expressed in the reti. The protein has the canonical features of a photoreceptive opsin protein.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 497% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Opsin-3 (1 products)

Catalog No. Species Pres. Purity   Source  

OPN3 overexpression lysate

OPN3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn