TA342921 NT5C1A antibody

Rabbit Polyclonal Anti-NT5C1A Antibody

See related secondary antibodies

Search for all "NT5C1A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NT5C1A

Product Description for NT5C1A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NT5C1A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NT5C1A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cytosolic 5'-nucleotidase 1A, Cytosolic 5'-nucleotidase IA, cN-I, cN-IA
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BXI3
Immunogen:
The immunogen for anti-NT5C1A antibody: synthetic peptide directed towards the C terminal of human NT5C1A. Synthetic peptide located within the following region: AHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIR.
GeneID:
84618
Application WB
Background Cytosolic nucleotidases, such as NT5C1A, dephosphorylate nucleoside monophosphates .
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 679% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NT5C1A (1 products)

Catalog No. Species Pres. Purity   Source  

NT5C1A

NT5C1A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.
  • LinkedIn