TA342989 ROPN1L / ASP antibody

Rabbit Polyclonal Anti-ROPN1L Antibody

See related secondary antibodies

Search for all "ROPN1L / ASP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ROPN1L / ASP

Product Description for ROPN1L / ASP

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ROPN1L / ASP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ROPN1L / ASP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AKAP-associated sperm protein, ROPN1-like protein, Ropporin-1-like protein
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96C74
Immunogen:
The immunogen for anti-ROPN1L antibody: synthetic peptide directed towards the N terminal of human ROPN1L. Synthetic peptide located within the following region: GYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVE.
GeneID:
83853
Application WB
Background This gene encodes a member of the ropporin family. The encoded protein is a sperm protein. It interacts with A-kise anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Type II regulatory subunit of cAMP-dependent protein kise (PKARII) also binds to this helix domain of AKAP3, which allows PKARII to be targeted to specific subcellular compartments. It is suggested that sperm contains several proteins that bind to AKAPs in a manner similar to PKARII, and this encoded protein may be one of them.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 747% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ROPN1L / ASP (3 products)

Catalog No. Species Pres. Purity   Source  

ROPN1L / ASP

ROPN1L / ASP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ROPN1L / ASP

ROPN1L / ASP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ROPN1L / ASP

ROPN1L / ASP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ROPN1L / ASP (3 products)

Catalog No. Species Pres. Purity   Source  

ROPN1L 293T Cell Transient Overexpression Lysate(Denatured)

ROPN1L 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ROPN1L overexpression lysate

ROPN1L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Ropporin 1-like Lysate

Western Blot: Ropporin 1-like Lysate [NBL1-15476] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ROPN1L
  Novus Biologicals Inc.
  • LinkedIn