TA343011 TBRG1 / NIAM antibody

Rabbit Polyclonal Anti-TBRG1 Antibody

See related secondary antibodies

Search for all "TBRG1 / NIAM"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TBRG1 / NIAM

Product Description for TBRG1 / NIAM

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TBRG1 / NIAM.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TBRG1 / NIAM

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Nuclear interactor of ARF and Mdm2, Transforming growth factor beta regulator 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3YBR2
Immunogen:
The immunogen for anti-TBRG1 antibody: synthetic peptide directed towards the N terminal of human TBRG1. Synthetic peptide located within the following region: KARMKKLPKKSQNEKYRLKYLRLRKAAKATVFENAAICDEIARLEEKFLK.
GeneID:
84897
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 769% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TBRG1 / NIAM (4 products)

Catalog No. Species Pres. Purity   Source  

TBRG1 / NIAM (transcript variant 1)

TBRG1 / NIAM Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TBRG1 / NIAM

TBRG1 / NIAM Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TBRG1 / NIAM

TBRG1 / NIAM Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TBRG1 / NIAM

TBRG1 / NIAM Human
  Abnova Taiwan Corp.
  • LinkedIn