TA343025 RAB2B antibody

Rabbit Polyclonal Anti-RAB2B Antibody

See related secondary antibodies

Search for all "RAB2B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Porcine RAB2B

Product Description for RAB2B

Rabbit anti Canine, Human, Porcine RAB2B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RAB2B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Rab-2B, Ras-related protein Rab-2B
Presentation Purified
Reactivity Can, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WUD1
Immunogen:
The immunogen for anti-RAB2B antibody: synthetic peptide directed towards the C terminal of human RAB2B. Synthetic peptide located within the following region: NTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGS.
GeneID:
84932
Application WB
Background Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 783% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB2B (7 products)

Catalog No. Species Pres. Purity   Source  

RAB2B

RAB2B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RAB2B (1-216, His-tag)

RAB2B Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

RAB2B (1-216, His-tag)

RAB2B Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

RAB2B

RAB2B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RAB2B

RAB2B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RAB2B

RAB2B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAB2B

RAB2B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RAB2B (2 products)

Catalog No. Species Pres. Purity   Source  

RAB2B Lysate

Western Blot: RAB2B Lysate [NBL1-15058] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RAB2B
  Novus Biologicals Inc.

RAB2B overexpression lysate

RAB2B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn