TA343046 MIA2 antibody

Rabbit Polyclonal Anti-MIA2 Antibody

See related secondary antibodies

Search for all "MIA2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MIA2

Product Description for MIA2

Rabbit anti Human MIA2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MIA2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Melanoma inhibitory activity protein 2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96PC5-2
Immunogen:
The immunogen for anti-MIA2 antibody: synthetic peptide directed towards the C terminal of human MIA2. Synthetic peptide located within the following region: NTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDT.
GeneID:
117153
Application WB
Background MIA2 may play a role in the pathophysiology of liver disease and may serve as a marker of liver damage.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 804% sucrose.
State:
Purified

Accessory Products

  • LinkedIn